Dyrk1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55096-25ul

Product Code. 18676076

Description

Dyrk1B Polyclonal specifically detects Dyrk1B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PRR13
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: DKFZP564J157, FLJ23818, proline rich 13, proline-rich protein 13, Taxane-resistance protein, TXR1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54458
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PRR13
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only