missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRPSAP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35590-100ul
This item is not returnable.
View return policy
Description
PRPSAP2 Polyclonal antibody specifically detects PRPSAP2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| PRPSAP2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| MGC117304, MGC126719, MGC126721, PAP4141 kDa phosphoribosypyrophosphate synthetase-associated protein, phosphoribosyl pyrophosphate synthase-associated protein 2, phosphoribosyl pyrophosphate synthetase-associated protein 2, PRPP synthase-associated protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 211-252 of human PRPSAP2 (NP_001340030.1).,, Sequence:, HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKP | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 5636 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction