missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRPS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | PRPS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
PRPS2 Polyclonal specifically detects PRPS2 in Human samples. It is validated for Western Blot.Specifications
| PRPS2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| P11908 | |
| 5634 | |
| Synthetic peptides corresponding to PRPS2(phosphoribosyl pyrophosphate synthetase 2) The peptide sequence was selected from the middle region of PRPS2. Peptide sequence ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| EC 2.7.6.1, Phosphoribosyl pyrophosphate synthase II, phosphoribosyl pyrophosphate synthetase 2, PPRibP, PPRibP synthetase, PRSII, PRS-II, ribose-phosphate diphosphokinase 2, ribose-phosphate pyrophosphokinase 2 | |
| PRPS2 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title