PRPS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56666

Product Code. 18235253

Description

PRPS2 Polyclonal specifically detects PRPS2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PRPS2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.6.1, Phosphoribosyl pyrophosphate synthase II, phosphoribosyl pyrophosphate synthetase 2, PPRibP, PPRibP synthetase, PRSII, PRS-II, ribose-phosphate diphosphokinase 2, ribose-phosphate pyrophosphokinase 2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 92%; Xenopus: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P11908
• Gene Symbols: PRPS2
• Immunogen: Synthetic peptides corresponding to PRPS2(phosphoribosyl pyrophosphate synthetase 2) The peptide sequence was selected from the N terminal of PRPS2. Peptide sequence MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 5634
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only