missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRP19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38381-25ul
This item is not returnable.
View return policy
Description
PRP19 Polyclonal specifically detects PRP19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| PRP19 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9UMS4 | |
| PRPF19 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQI | |
| 25 μL | |
| Apoptosis, Cancer, DNA Repair, GPCR, Tumor Suppressors | |
| 27339 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| hPSO4, NMP200SNEV, Nuclear matrix protein 200, nuclear matrix protein NMP200 related to splicing factor PRP19, pre-mRNA-processing factor 19, PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), PRP19PRP19/PSO4 homolog (S. cerevisiae), PSO4PRP19/PSO4 homolog, Senescence evasion factor, UBOX4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction