missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protocadherin gamma C3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Protocadherin gamma C3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Protocadherin gamma C3 Polyclonal specifically detects Protocadherin gamma C3 in Human samples. It is validated for Western Blot.Specifications
| Protocadherin gamma C3 | |
| Polyclonal | |
| Rabbit | |
| Q9UN70-2 | |
| 5098 | |
| Synthetic peptides corresponding to PCDHGC3(protocadherin gamma subfamily C, 3) The peptide sequence was selected from the N terminal of PCDHGC3. Peptide sequence ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cadherin-like 2, PC43, PC-43, PCDH2, PCDH-GAMMA-C3, protocadherin 2, protocadherin 43, protocadherin gamma subfamily C, 3, protocadherin gamma-C3, protocadherin-2, Protocadherin-43 | |
| PCDHGC3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title