missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protocadherin-8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Protocadherin-8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Protocadherin-8 Polyclonal specifically detects Protocadherin-8 in Human samples. It is validated for Western Blot.Specifications
| Protocadherin-8 | |
| Polyclonal | |
| Rabbit | |
| Q5TAN1 | |
| 5100 | |
| Synthetic peptides corresponding to PCDH8(protocadherin 8) The peptide sequence was selected from the middle region of PCDH8. Peptide sequence GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ARCADLIN, PAPC, protocadherin 8, protocadherin-8 | |
| PCDH8 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title