missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protocadherin-17 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£156.00 - £364.00
Specifications
| Antigen | Protocadherin-17 |
|---|---|
| Dilution | Western Blot 1:500-1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Protocadherin-17 Polyclonal antibody specifically detects Protocadherin-17 in Human samples. It is validated for Western BlotSpecifications
| Protocadherin-17 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 27253 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| PCDH68protocadherin-68, PCH68Protocadherin-68, protocadherin 17, protocadherin 68, protocadherin-17 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PCDH17 (NP_001035519.1). VRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title