Protein Phosphatase 1 beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
30231945	Novus Biologicals NBP3-35355-100ul	100 μL
30229489	Novus Biologicals NBP3-35355-20ul	20 μL

Descrizione

Protein Phosphatase 1 beta Polyclonal antibody specifically detects Protein Phosphatase 1 beta in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifica

• Antigen: Protein Phosphatase 1 beta
• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cancer, Lipid and Metabolism, Protein Phosphatase
• Formulation: PBS (pH 7.3), 50% glycerol
• Gene ID (Entrez): 5500
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: EC 3.1.3.16, EC 3.1.3.53, MGC3672, PP1beta, PP-1Bprotein phosphatase 1, catalytic subunit, delta isoform, PPP1CD, protein phosphatase 1, catalytic subunit, beta isoform, protein phosphatase 1, catalytic subunit, beta isozyme, protein phosphatase 1-beta, protein phosphatase 1-delta, serine/threonine protein phosphatase PP1-beta catalytic subunit, serine/threonine-protein phosphatase PP1-beta catalytic subunit
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 227-327 of human Protein Phosphatase 1 beta (NP_002700.1).,, Sequence:, VEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
• Primary or Secondary: Primary
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.