missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Protein kinase-like protein SgK493 Antibody, Novus Biologicals™

Protein kinase-like protein SgK493 Antibody, Novus Biologicals™

Product Code. 18426640 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18426640 0.1 mL 0.1mL
18457970 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18426640 Supplier Novus Biologicals Supplier No. NBP180757

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Protein kinase-like protein SgK493 Polyclonal antibody specifically detects Protein kinase-like protein SgK493 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Protein kinase-like protein SgK493
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Accession No. Q504Y2
Gene Alias EC 2.7, FLJ18197, MGC125960, protein kinase domain containing, cytoplasmic homolog (mouse), protein kinase domain-containing protein, cytoplasmic, Protein kinase-like protein SgK493, SgK493, Sugen kinase 493, Vertebrate lonesome kinase, Vlk
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 91461
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.