missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protein Kinase A Regulatory Subunit II alpha Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Protein Kinase A Regulatory Subunit II alpha Polyclonal specifically detects Protein Kinase A Regulatory Subunit II alpha in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Protein Kinase A Regulatory Subunit II alpha |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human Protein Kinase A Regulatory Subunit II alpha (NP_004148). Peptide sequence IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS |
| Purification Method | Affinity purified |
| Quantity | 100 μg |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?