missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proteasome 20S beta 6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88024-25ul
This item is not returnable.
View return policy
Description
Proteasome 20S beta 6 Polyclonal specifically detects Proteasome 20S beta 6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Proteasome 20S beta 6 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PSMB6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLT | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 5694 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction