missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proteasome 20S beta 6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Proteasome 20S beta 6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Proteasome 20S beta 6 Polyclonal specifically detects Proteasome 20S beta 6 in Human samples. It is validated for Western Blot.Specifications
| Proteasome 20S beta 6 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| DELTA, EC 3.4.25.1, LMPY, Macropain delta chain, Multicatalytic endopeptidase complex delta chain, proteasome (prosome, macropain) subunit, beta type, 6, proteasome catalytic subunit 1, Proteasome delta chain, proteasome subunit beta 6, proteasome subunit beta type-6, proteasome subunit delta, Proteasome subunit Y, PSY large multifunctional protease Y, YMGC5169 | |
| PSMB6 | |
| IgG | |
| This product is specific to Subunit or Isoform: beta type-6. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P28072 | |
| 5694 | |
| Synthetic peptides corresponding to PSMB6(proteasome (prosome, macropain) subunit, beta type, 6) The peptide sequence was selected from the N terminal of PSMB6. Peptide sequence TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title