missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proteasome 19S S7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | Proteasome 19S S7 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18232633
|
Novus Biologicals
NBP2-56743 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18655388
|
Novus Biologicals
NBP2-56743-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Proteasome 19S S7 Polyclonal specifically detects Proteasome 19S S7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Proteasome 19S S7 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience, Ubiquitin Proteasome Pathway | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5701 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 26S protease regulatory subunit 7, 26S proteasome AAA-ATPase subunit RPT1, MGC3004, MSS1ATPase, 2, proteasome (prosome, macropain) 26S subunit, ATPase, 2, Protein MSS1, putative protein product of Nbla10058 | |
| PSMC2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title