missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Proteasome 19S 10B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Proteasome 19S 10B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18335226 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18335226 25 μg 25µL
18327876 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18335226 Supplier Novus Biologicals Supplier No. NBP31701925UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Proteasome 19S 10B Polyclonal antibody specifically detects Proteasome 19S 10B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Proteasome 19S 10B
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 26S proteasome regulatory subunit RPN1, 26S proteasome regulatory subunit S2, MGC14274,55.11 protein, P97, proteasome (prosome, macropain) 26S subunit, non-ATPase, 2, Protein 55.11, Rpn1, S226S proteasome non-ATPase regulatory subunit 2, TNFR-associated protein 2, TRAP226S proteasome subunit p97, tumor necrosis factor receptor-associated protein 2, Tumor necrosis factor type 1 receptor-associated protein 2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKD
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Neuroscience, Ubiquitin Proteasome Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5708
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.