missing translation for 'onlineSavingsMsg'
Learn More

Proprotein Convertase 2/PCSK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£362.00

Specifications

Antigen	Proprotein Convertase 2/PCSK2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18234211 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-69146	100 μL	£362.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Proprotein Convertase 2/PCSK2 Polyclonal specifically detects Proprotein Convertase 2/PCSK2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Proprotein Convertase 2/PCSK2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Chromatin Research, Golgi Apparatus Markers, Neuroscience
Gene ID (Entrez)	5126
Immunogen	Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	EC 3.4.21, EC 3.4.21.94, KEX2-like endoprotease 2, NEC 2, NEC2SPC2, neuroendocrine convertase 2, PC2NEC-2, Prohormone convertase 2, Proprotein convertase 2, proprotein convertase subtilisin/kexin type 2
Gene Symbols	PCSK2
Isotype	IgG
Molecular Weight of Antigen	58 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Proprotein Convertase 2/PCSK2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents