missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proprotein Convertase 2/PCSK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69146
This item is not returnable.
View return policy
Description
Proprotein Convertase 2/PCSK2 Polyclonal specifically detects Proprotein Convertase 2/PCSK2 in Human samples. It is validated for Western Blot.
Specifications
| Proprotein Convertase 2/PCSK2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| PCSK2 | |
| Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| EC 3.4.21, EC 3.4.21.94, KEX2-like endoprotease 2, NEC 2, NEC2SPC2, neuroendocrine convertase 2, PC2NEC-2, Prohormone convertase 2, Proprotein convertase 2, proprotein convertase subtilisin/kexin type 2 | |
| Rabbit | |
| 58 kDa | |
| 100 μL | |
| Chromatin Research, Golgi Apparatus Markers, Neuroscience | |
| 5126 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction