missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Prolyl endopeptidase-like Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Prolyl endopeptidase-like Polyclonal specifically detects Prolyl endopeptidase-like in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Prolyl endopeptidase-like |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EC 3.4.21, EC 3.4.21.-, EC 3.4.21.83, KIAA0436FLJ16627, prolyl endopeptidase-like, Prolylendopeptidase-like, putative prolyl oligopeptidase |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prolyl endopeptidase-like (NP_666096). Peptide sequence LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?