missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Prolactin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £386.00
Specifications
| Antigen | Prolactin |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18250895
|
Novus Biologicals
NBP2-56148 |
100 μL |
£386.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18616048
|
Novus Biologicals
NBP2-56148-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Prolactin Polyclonal specifically detects Prolactin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Prolactin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 5617 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| prolactin | |
| PRL | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title