missing translation for 'onlineSavingsMsg'
Learn More

Prokineticin R1/PROKR1 Antibody, Novus Biologicals™

Product Code. 18407870 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18407870 25 μL 25µL
18410451 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18407870 Supplier Novus Biologicals Supplier No. NBP18333725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Prokineticin R1/PROKR1 Polyclonal antibody specifically detects Prokineticin R1/PROKR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Prokineticin R1/PROKR1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias G protein-coupled receptor 73, G protein-coupled receptor ZAQ, GPR73, GPR73aG-protein coupled receptor 73, PK-R1, PKR1G-protein coupled receptor ZAQ, prokineticin receptor 1, ZAQ
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 10887
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.