missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PRL-2/PTP4A2 Monoclonal antibody specifically detects PRL-2/PTP4A2 in Human samples. It is validated for ELISA, ELISA
Specifications
Specifications
| Antigen | PRL-2/PTP4A2 |
| Applications | ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 3C2 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | EC 3.1.3.48, HU-PP-1HH13, OV-1PTP4A, PRL-2HH7-2, PRL2protein tyrosine phosphatase IVA, protein tyrosine phosphatase IVA2, protein tyrosine phosphatase type IVA 2, protein tyrosine phosphatase type IVA, member 2, Protein-tyrosine phosphatase 4a2, Protein-tyrosine phosphatase of regenerating liver 2, PTP(CAAXII), PTPCAAX2phosphatase of regenerating liver 2, ptp-IV1a, ptp-IV1b |
| Host Species | Mouse |
| Immunogen | PTP4A2 (NP_003470.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGC |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?