missing translation for 'onlineSavingsMsg'
Learn More

PRKRIR Antibody, Novus Biologicals™

Product Code. 18358078 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358078 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18358078 Supplier Novus Biologicals Supplier No. H00005612B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

PRKRIR Polyclonal antibody specifically detects PRKRIR in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PRKRIR
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH21992.1
Gene Alias 58 kDa interferon-induced protein kinase-interacting protein, DAP452 kDa repressor of the inhibitor of the protein kinase, Death-associated protein 4, inhibitor of protein kinase PKR, MGC102750, p52rIPK, p58IPK-interacting protein, protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor), THAP domain-containing protein 0, THAP0
Host Species Mouse
Immunogen PRKRIR (AAH21992.1, 1 a.a. - 150 a.a.) full-length human protein. MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5612
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.