missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Presenilin-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £409.00
Specifications
| Antigen | Presenilin-1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18235664
|
Novus Biologicals
NBP2-57002 |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18676336
|
Novus Biologicals
NBP2-57002-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Presenilin-1 Polyclonal specifically detects Presenilin-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Presenilin-1 | |
| Polyclonal | |
| Rabbit | |
| Alzheimers Research, Apoptosis, Cancer, Hematopoietic Stem Cell Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers, Stem Cell Signaling Pathway, Tumor Suppressors, Wnt Signaling Pathway | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5663 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AD3EC 3.4.23.-, Alzheimer disease 3, EC 3.4.23, FAD, presenilin 1, Protein S182, PS-1, PS1presenilin-1, PSNL1, S182 | |
| PSEN1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title