missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRDM16/MEL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | PRDM16/MEL1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18215402
|
Novus Biologicals
NBP2-58350 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18672797
|
Novus Biologicals
NBP2-58350-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PRDM16/MEL1 Polyclonal specifically detects PRDM16/MEL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| PRDM16/MEL1 | |
| Polyclonal | |
| Rabbit | |
| Chromatin Research | |
| MDS1/EVI1-like gene 1, MEL1KIAA1675PFM13MGC166915, PR domain containing 16, PR domain zinc finger protein 16, PR domain-containing protein 16, Transcription factor MEL1 | |
| PRDM16 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 63976 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHEHENAPVSQHPGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title