PRDC/GREM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57598

Product Code. 18278502

Description

PRDC/GREM2 Polyclonal specifically detects PRDC/GREM2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PRDC/GREM2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CKTSF1B2FLJ21195, Cysteine knot superfamily 1, BMP antagonist 2, DAN domain family member 3, DAND3Prdc, gremlin 2, gremlin 2, cysteine knot superfamily, homolog, gremlin-2, PRDCgremlin 2, cysteine knot superfamily, homolog (Xenopus laevis), Protein related to DAN and cerberus
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H772
• Gene Symbols: GREM2
• Immunogen: Synthetic peptides corresponding to GREM2 (gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis)) The peptide sequence was selected from the N terminal of GREM2)(50ug). Peptide sequence MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 64388
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig
• Isotype: IgG

For Research Use Only