missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PQLC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PQLC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PQLC1 Polyclonal specifically detects PQLC1 in Human samples. It is validated for Western Blot.Specifications
| PQLC1 | |
| Polyclonal | |
| Rabbit | |
| Q8N2U9 | |
| 80148 | |
| Synthetic peptides corresponding to PQLC1(PQ loop repeat containing 1) The peptide sequence was selected from the middle region of PQLC1. Peptide sequence TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ22378, PQ loop repeat containing 1, PQ-loop repeat-containing protein 1 | |
| PQLC1 | |
| IgG | |
| 30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title