missing translation for 'onlineSavingsMsg'
Learn More

PPP3CC Antibody (4D1), Novus Biologicals™

Product Code. 18327548 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327548 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327548 Supplier Novus Biologicals Supplier No. H00005533M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

PPP3CC Monoclonal antibody specifically detects PPP3CC in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPP3CC
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4D1
Conjugate Unconjugated
Dilution Western Blot, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005596.2
Gene Alias Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, CALNA3CAM-PRP catalytic subunit, CNA3, EC 3.1.3.16, PP2Bgamma, protein phosphatase 2B, catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma), protein phosphatase 3, catalytic subunit, gamma isozyme, serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
Host Species Mouse
Immunogen PPP3CC (NP_005596.2, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline B Cell Development and Differentiation Markers, Cell Biology, Cytoskeleton Markers, Immunology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5533
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.