missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18358578

PPP3CB Antibody (5D3), Novus Biologicals™

Product Code. 18358578 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358578 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18358578 Supplier Novus Biologicals Supplier No. H00005532M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

PPP3CB Monoclonal antibody specifically detects PPP3CB in Human samples. It is validated for Western Blot, ELISA, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPP3CB
Applications Western Blot, ELISA, Sandwich ELISA, KnockDown
Classification Monoclonal
Clone 5D3
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_066955
Gene Alias Calmodulin-dependent calcineurin A subunit beta isoform, CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta), CAM-PRP catalytic subunit, CNA2catalytic subunit, beta isoform, EC 3.1.3.16, protein phosphatase 2B, catalytic subunit, beta isoform, protein phosphatase 3, catalytic subunit, beta isozyme, protein phosphatase from PCR fragment H32, serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Host Species Mouse
Immunogen PPP3CB (NP_066955, 435 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5532
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.