missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPP2R5B Antibody, Novus Biologicals™

PPP2R5B Antibody, Novus Biologicals™

Product Code. 18403481 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18403481 25 μL 25µL
18740694 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18403481 Supplier Novus Biologicals Supplier No. NBP18895825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PPP2R5B Polyclonal specifically detects PPP2R5B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPP2R5B
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias B56B, FLJ35411, PP2A B subunit isoform B56-beta, PP2A B subunit isoform B'-beta, PP2A B subunit isoform PR61-beta, PP2A B subunit isoform R5-beta, PR61B, protein phosphatase 2, regulatory subunit B (B56), beta isoform, protein phosphatase 2, regulatory subunit B', beta, protein phosphatase 2, regulatory subunit B', beta isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
Gene Symbols PPP2R5B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5526
Test Specificity Specificity of human PPP2R5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.