missing translation for 'onlineSavingsMsg'
Learn More

PPP2R2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£145.00 - £417.00

Specifications

Antigen	PPP2R2B
Dilution	Western Blot 1:500 - 1:2000, ELISA
Applications	ELISA, Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
30230947 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-35878-100ul	100 μL	£417.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

30232639 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-35878-20ul	20 μL	£145.00 20µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

PPP2R2B Polyclonal antibody specifically detects PPP2R2B in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

Antigen	PPP2R2B
Applications	ELISA, Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Stem Cell Markers
Formulation	PBS (pH 7.3), 50% glycerol
Gene ID (Entrez)	5521
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 1:500 - 1:2000, ELISA
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	B55BETA, FLJ95686, MGC24888, PP2A subunit B isoform B55-beta, PP2A subunit B isoform beta, PP2A subunit B isoform PR55-beta, PP2A subunit B isoform R2-beta, PP2A, subunit B, B-beta isoform, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55BETA, PR55-BETA, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform, protein phosphatase 2, regulatory subunit B, beta, SCA12, serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform, serine/threonine protein phosphatase 2A, neuronal isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform, spinocerebellar ataxia 12
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 108-220 of human PPP2R2B (NP_858060.2).,, Sequence:, GDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLR
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

PPP2R2B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents