missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPP2R2B Antibody, Novus Biologicals™

PPP2R2B Antibody, Novus Biologicals™

Product Code. 18424291 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18424291 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18424291 Supplier Novus Biologicals Supplier No. NBP19228325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PPP2R2B Polyclonal specifically detects PPP2R2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPP2R2B
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias B55BETA, FLJ95686, MGC24888, PP2A subunit B isoform B55-beta, PP2A subunit B isoform beta, PP2A subunit B isoform PR55-beta, PP2A subunit B isoform R2-beta, PP2A, subunit B, B-beta isoform, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55BETA, PR55-BETA, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform, protein phosphatase 2, regulatory subunit B, beta, SCA12, serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform, serine/threonine protein phosphatase 2A, neuronal isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform, spinocerebellar ataxia 12
Gene Symbols PPP2R2B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 5521
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.