missing translation for 'onlineSavingsMsg'
Learn More

PPP2R2A Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Product Code. 18374794 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18374794 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18374794 Supplier Novus Biologicals Supplier No. NBP309343100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PPP2R2A Polyclonal specifically detects PPP2R2A in Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPP2R2A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias B55A, B55ALPHA, DKFZp686N05117, FLJ26613, FLJ41727, MGC52248, PP2A subunit B isoform alpha, PP2A subunit B isoform B55-alpha, PP2A subunit B isoform PR55-alpha, PP2A subunit B isoform R2-alpha, PR52A, PR55A, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform, protein phosphatase 2, regulatory subunit B, alpha, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Rat PPP2R2A (NP_446451). Peptide sequence ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5520
Target Species Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.