PPP2R2A Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33476-100ul

Product Code. 30231028

Description

PPP2R2A Monoclonal antibody specifically detects PPP2R2A in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: PPP2R2A
• Classification: Monoclonal
• Dilution: Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: B55A, B55ALPHA, DKFZp686N05117, FLJ26613, FLJ41727, MGC52248, PP2A subunit B isoform alpha, PP2A subunit B isoform B55-alpha, PP2A subunit B isoform PR55-alpha, PP2A subunit B isoform R2-alpha, PR52A, PR55A, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform, protein phosphatase 2, regulatory subunit B, alpha, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 94-194 of human PPP2R2A (NP_002708.1).,, Sequence:, EKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLS
• Quantity: 100 μL
• Research Discipline: Cell Biology, Cell Cycle and Replication, Neuroscience, Signal Transduction
• Gene ID (Entrez): 5520
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified