missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PPP1R3A Polyclonal antibody specifically detects PPP1R3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | PPP1R3A |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle, GM, PP1G, PPP1R3, protein phosphatase 1 glycogen- associated regulatory subunit, Protein phosphatase 1 glycogen-associated regulatory subunit, protein phosphatase 1 regulatory subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle), Protein phosphatase type-1 glycogen targeting subunit, RG1, serine/threonine specific protein phosphatase, type-1 protein phosphatase skeletal muscle glycogen targeting subunit |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?