PPP1R35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-30996-25ul

Code produit. 18463932

Description

PPP1R35 Polyclonal specifically detects PPP1R35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

• Antigen: PPP1R35
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q8TAP8
• Gene Symbols: PPP1R35
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C7orf47, Chromosome 7 Open Reading Frame 47, Protein Phosphatase 1 Regulatory Subunit 35, Protein Phosphatase 1, Regulatory Subunit 35, UPF0683 Protein C7orf47
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 221908
• Target Species: Human
• Isotype: IgG

For Research Use Only