missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18341919

PPP1R14B Antibody (4G2), Novus Biologicals™

Product Code. 18341919 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18341919 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18341919 Supplier Novus Biologicals Supplier No. H00026472M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

PPP1R14B Monoclonal antibody specifically detects PPP1R14B in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPP1R14B
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4G2
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_619634.1
Gene Alias PHI-1, PLCB3Nphospholipase C beta-3 neighboring gene protein, PNGPhospholipase C-beta-3 neighbouring gene protein, protein phosphatase 1 regulatory subunit 14B, protein phosphatase 1, regulatory (inhibitor) subunit 14B, SOM172
Host Species Mouse
Immunogen PPP1R14B (NP_619634.1, 64 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 26472
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.