missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPME1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£248.00 - £513.00
Specifications
| Antigen | PPME1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18609055
|
Novus Biologicals
NBP2-38515-25ul |
25 μL |
£248.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18151919
|
Novus Biologicals
NBP2-38515 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PPME1 Polyclonal specifically detects PPME1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PPME1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.1.1, EC 3.1.1.-, FLJ22226, PME-1PME1, protein phosphatase methylesterase 1, protein phosphatase methylesterase-1 | |
| PPME1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9Y570 | |
| 51400 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title