missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPM1K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85037
This item is not returnable.
View return policy
Description
PPM1K Polyclonal specifically detects PPM1K in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PPM1K | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp667B084, DKFZp761G058, mitochondrial, PP2C domain-containing protein phosphatase 1K, PP2Ckappa, PP2C-like mitochondrial protein, PP2Cm, PP2C-type mitochondrial phosphoprotein phosphatase, protein phosphatase 2C kappa, protein phosphatase, Mg2+/Mn2+ dependent, 1K, PTMPEC 3.1.3.16 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PPM1K | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHTHMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHAR | |
| 0.1 mL | |
| Protein Phosphatase | |
| 152926 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction