missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPM1K Antibody, Novus Biologicals™

PPM1K Antibody, Novus Biologicals™

Product Code. 18416760 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18416760 25ul 25µL
18287936 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18416760 Supplier Novus Biologicals Supplier No. NBP18503525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

PPM1K Polyclonal specifically detects PPM1K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPM1K
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DKFZp667B084, DKFZp761G058, mitochondrial, PP2C domain-containing protein phosphatase 1K, PP2Ckappa, PP2C-like mitochondrial protein, PP2Cm, PP2C-type mitochondrial phosphoprotein phosphatase, protein phosphatase 2C kappa, protein phosphatase, Mg2+/Mn2+ dependent, 1K, PTMPEC 3.1.3.16
Gene Symbols PPM1K
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PETKRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFS
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Protein Phosphatase
Primary or Secondary Primary
Gene ID (Entrez) 152926
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.