PPM1K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP1-85035

Product Code. 18287936

Description

PPM1K Polyclonal specifically detects PPM1K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifikationer

• Antigen: PPM1K
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
• Gene Alias: DKFZp667B084, DKFZp761G058, mitochondrial, PP2C domain-containing protein phosphatase 1K, PP2Ckappa, PP2C-like mitochondrial protein, PP2Cm, PP2C-type mitochondrial phosphoprotein phosphatase, protein phosphatase 2C kappa, protein phosphatase, Mg2+/Mn2+ dependent, 1K, PTMPEC 3.1.3.16
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPM1K
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PETKRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFS
• Quantity: 0.1 mL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 152926
• Target Species: Human
• Isotype: IgG

For Research Use Only