PPM1H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38859-25ul

Product Code. 18620516

Description

PPM1H Polyclonal specifically detects PPM1H in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPM1H
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9ULR3
• Gene Symbols: PPM1H
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ARHCL1, FLJ13253, KIAA1157, member C like 1, NERPP-2C, neurite extension-related protein phosphatase related to PP2C, protein phosphatase 1H, protein phosphatase 1H (PP2C domain containing), protein phosphatase, Mg2+/Mn2+ dependent, 1H, URCC2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57460
• Target Species: Human
• Isotype: IgG