missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPIL6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

PPIL6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18358281
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358281 25 μg 25µL
18390106 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18358281 Supplier Bio-Techne Supplier No. NBP31741925UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PPIL6 Polyclonal antibody specifically detects PPIL6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPIL6
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias bA425D10.6, Cyclophilin-like protein PPIL6, dJ919F19.1, EC 5.2.1.8, MGC27054, MGC27056, MGC41939, peptidyl-prolyl cis-trans isomerase-like 6, peptidyl-prolyl cis-trans isomerase-like variant a, peptidylprolyl isomerase (cyclophilin)-like 6, PPIase, radial spoke 12 homolog, Rotamase PPIL6, RSPH12
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEGTEVLKQLELVPTQNERPI
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 285755
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.