missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPIL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | PPIL4 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18281342
|
Novus Biologicals
NBP2-55080 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688758
|
Novus Biologicals
NBP2-55080-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PPIL4 Polyclonal specifically detects PPIL4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| PPIL4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 85313 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Cyclophilin-like protein PPIL4, cyclophilin-type peptidyl-prolyl cis-trans isomerase, EC 5.2.1.8, HDCME13P, peptidyl-prolyl cis-trans isomerase-like 4, peptidylprolyl isomerase (cyclophilin)-like 4, PPIase, Rotamase PPIL4, serologically defined breast cancer antigen NY-BR-18 | |
| PPIL4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title