missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PPIG Monoclonal antibody specifically detects PPIG in Human samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | PPIG |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 4F7 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_004783 |
| Gene Alias | CARS-cyclophilin, CARS-CypPPIase G, CASP10, Clk-associating RS-cyclophilin, Cyclophilin G, CYP, EC 5.2.1.8, MGC133241, peptidyl-prolyl cis-trans isomerase G, Peptidyl-prolyl isomerase G, peptidylprolyl isomerase G (cyclophilin G), peptidyl-prolyl isomerase G (cyclophilin G), Rotamase G, SCAF10, SR-cyclophilin, SRcyp, SR-cyp, SR-related CTD-associated factor 10 |
| Host Species | Mouse |
| Immunogen | PPIG (NP_004783, 13 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNK |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?