missing translation for 'onlineSavingsMsg'
Learn More

PPAP2A Antibody, Novus Biologicals™

Product Code. 18352319 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18352319 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18352319 Supplier Novus Biologicals Supplier No. H00008611D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PPAP2A Polyclonal antibody specifically detects PPAP2A in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PPAP2A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_003702.2
Gene Alias EC 3.1.3.4, lipid phosphate phosphohydrolase 1, lipid phosphate phosphohydrolase 1a, LLP1a, LPP1PAP2a2, PAP2, PAP2a, PAP2-alpha, PAP-2aPAP2alpha2, PAPalpha1, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, phosphatidic acid phosphatase type 2A, phosphatidic acid phosphohydrolase type 2a, type 2 phosphatidic acid phosphohydrolase, type-2 phosphatidic acid phosphatase alpha
Host Species Rabbit
Immunogen PPAP2A (NP_003702.2, 1 a.a. - 284 a.a.) full-length human protein. MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Purification Method Protein G purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 8611
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.