missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PP2C gamma/PPM1G Polyclonal specifically detects PP2C gamma/PPM1G in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
Specifications
| Antigen | PP2C gamma/PPM1G |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Knockdown Validated |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | EC 3.1.3.16, MGC1675, MGC2870, PP2C, gamma, PP2CG, PP2C-gamma, PP2CGAMMA, PPM1C, PPP2CG, Protein phosphatase 1C, protein phosphatase 1G, protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, protein phosphatase 2, catalytic subunit, gamma isoform, protein phosphatase 2C gamma isoform, Protein phosphatase 2C isoform gamma, Protein phosphatase magnesium-dependent 1 gamma, protein phosphatase, Mg2+/Mn2+ dependent, 1G |
| Gene Symbols | PPM1G |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?