missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PP2C epsilon/PPM1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | PP2C epsilon/PPM1L |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18481671
|
Novus Biologicals
NBP1-87247-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18243477
|
Novus Biologicals
NBP1-87247 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PP2C epsilon/PPM1L Polyclonal specifically detects PP2C epsilon/PPM1L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PP2C epsilon/PPM1L | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 3.1.3, EC 3.1.3.16, MGC132545, MGC132547, PP2C epsilon, PP2CEProtein phosphatase 2C isoform epsilon, PP2C-epsilon, PPM1-LIKE, protein phosphatase 1 (formerly 2C)-like, protein phosphatase 1L, Protein phosphatase 1-like, Protein phosphatase 2C epsilon isoform, protein phosphatase, Mg2+/Mn2+ dependent, 1L | |
| PPM1L | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 151742 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title