missing translation for 'onlineSavingsMsg'
Learn More

POU6F2 Antibody (1D3), Novus Biologicals™

Product Code. 18330969 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18330969 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18330969 Supplier Novus Biologicals Supplier No. H00011281M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

POU6F2 Monoclonal antibody specifically detects POU6F2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen POU6F2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1D3
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_009183
Gene Alias POU class 6 homeobox 2, Retina-derived POU domain factor 1, retina-derived POU-domain factor-1, RPF1, RPF-1, RPF-1class 6, transcription factor 2, Wilms tumor suppressor locus, WT5, WTSL
Host Species Mouse
Immunogen POU6F2 (NP_009183, 2 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11281
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.