missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18385079

POU4F3 Antibody (5B8), Novus Biologicals™

Product Code. 18385079 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18385079 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18385079 Supplier Novus Biologicals Supplier No. H00005459M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

POU4F3 Monoclonal antibody specifically detects POU4F3 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen POU4F3
Applications Western Blot, ELISA, Immunocytochemistry, KnockDown
Classification Monoclonal
Clone 5B8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002691
Gene Alias brain-3C, Brain-specific homeobox/POU domain protein 3C, BRN3.1, Brn-3C, BRN3Cbrn-3C, DFNA15, MGC138412, POU class 4 homeobox 3, POU domain class 4, transcription factor 3, POU domain, class 4, transcription factor 3
Host Species Mouse
Immunogen POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience, Vision
Primary or Secondary Primary
Gene ID (Entrez) 5459
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.