missing translation for 'onlineSavingsMsg'
Learn More
Learn More
POU3F2/OCT7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | POU3F2/OCT7 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18204333
|
Novus Biologicals
NBP2-55453 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635197
|
Novus Biologicals
NBP2-55453-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
POU3F2/OCT7 Polyclonal specifically detects POU3F2/OCT7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| POU3F2/OCT7 | |
| Polyclonal | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5454 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3 | |
| POU3F2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title